PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0047200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 254aa    MW: 28529.1 Da    PI: 4.8515
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0047200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.48.8e-26122172252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      e  i++e++s+yF+ pi+ AAkeL+++lT LK++CR++GI+RWPhRk+ksl
  Spipo11G0047200 122 ERAITFEEVSRYFYVPITVAAKELKMGLTQLKKKCRELGIPRWPHRKMKSL 172
                      678**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.336108193IPR003035RWP-RK domain
PfamPF020421.0E-20125172IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MMALALNSLD LMDYHQELAN WLGEPGGVAT EEEHADFSGS SLCDWRFDGD VEAGVPDTLP  60
LQQLPDHFFP SHDLFQDFSS TFCVESIAGD IAGEKDPHLD VASHEVDEIT KVAADGGGER  120
EERAITFEEV SRYFYVPITV AAKELKMGLT QLKKKCRELG IPRWPHRKMK SLQALISNVQ  180
ELGREDGEMG ETQLQRAIEI LEREREAMER VPGTQLEERT KRLRQACFKA NFKKRRRSKA  240
AGGGETWNHV AEV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939773.14e-64PREDICTED: protein RKD1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-38RWP-RK domain-containing protein